PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010917234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 412aa    MW: 46955.7 Da    PI: 4.9597
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010917234.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.98.8e-45361602127
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     ppG+rF+P+d+el+ +yL++k+++++l   +v+++v++y+++P +L +k+k+ ++++wyfF++rd+ky++g r+nr+t +gyWkatg +k++++ 
  XP_010917234.1  36 PPGYRFNPRDDELILHYLRRKIANEPLLY-DVFNDVNLYEYHPATLVEKFKHcGDNRWYFFTPRDRKYPNGIRPNRKTVDGYWKATGVEKKIIH- 128
                     9*************************888.99**************8655554899**************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                     +ge++g++k Lvfy+g+a kg+ktdW+m ey 
  XP_010917234.1 129 DGEQIGVRKALVFYTGKAGKGSKTDWIMYEYI 160
                     999****************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-5233188IPR003441NAC domain
PROSITE profilePS5100550.94235188IPR003441NAC domain
PfamPF023652.1E-2436159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MADSMASNPE SSMDKGNEEE EDIVIDTRQG PDSRFPPGYR FNPRDDELIL HYLRRKIANE  60
PLLYDVFNDV NLYEYHPATL VEKFKHCGDN RWYFFTPRDR KYPNGIRPNR KTVDGYWKAT  120
GVEKKIIHDG EQIGVRKALV FYTGKAGKGS KTDWIMYEYI NQDRSNRPRR PDGTMKLDDW  180
VLCTIQKKRG ADEDTGGEPE EPTQAQQAST SQSREQKQPR ADEENSGEPE GPPKAQQATT  240
SRSTEKPGTS QVQQIPHDGR EVEPLDYQVI HNNNGSHVNY YDMDGHANYN TGSVTQAPSM  300
SLPNDFTGFI SSDDIGDHHP SAQNFQQDIL NPSMRSIDLG YQLGQTPEFG FENQQMISES  360
LYPSPPEDPL DQRFSKNRDI IQIKHINIHS HIYCLSLNSA LDVYAIFEGM IG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-503519317170NO APICAL MERISTEM PROTEIN
1ut4_B5e-503519317170NO APICAL MERISTEM PROTEIN
1ut7_A5e-503519317170NO APICAL MERISTEM PROTEIN
1ut7_B5e-503519317170NO APICAL MERISTEM PROTEIN
4dul_A5e-503519317170NAC domain-containing protein 19
4dul_B5e-503519317170NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917234.10.0PREDICTED: NAC domain-containing protein 4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP158671313
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.13e-56NAC-like, activated by AP3/PI